PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID evm.model.supercontig_1.76
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Caricaceae; Carica
Family WRKY
Protein Properties Length: 542aa    MW: 58633.6 Da    PI: 7.516
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
evm.model.supercontig_1.76genomeASGPBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY109.51.6e-34258314259
                                 --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                        WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                 dDgynWrKYGqK+vkgsefprsYY+Ct+++Cpvkkkvers  d++++ei+Y+g+Hnh+
  evm.model.supercontig_1.76 258 DDGYNWRKYGQKQVKGSEFPRSYYKCTHPSCPVKKKVERSL-DGQITEIIYKGQHNHQ 314
                                 8****************************************.***************8 PP

2WRKY105.33.1e-33433491159
                                 ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
                        WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                                 ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++d ++v++tYeg+Hnhe
  evm.model.supercontig_1.76 433 LDDGYKWRKYGQKVVKGNPYPRSYYKCTTPGCNVRKHVERASTDARAVITTYEGKHNHE 491
                                 59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081123.72252316IPR003657WRKY domain
Gene3DG3DSA:2.20.25.803.8E-30253316IPR003657WRKY domain
SuperFamilySSF1182901.83E-26255316IPR003657WRKY domain
SMARTSM007742.3E-38257315IPR003657WRKY domain
PfamPF031063.7E-26258314IPR003657WRKY domain
Gene3DG3DSA:2.20.25.801.5E-36418493IPR003657WRKY domain
SuperFamilySSF1182905.75E-29425493IPR003657WRKY domain
PROSITE profilePS5081137.929428493IPR003657WRKY domain
SMARTSM007742.0E-38433492IPR003657WRKY domain
PfamPF031062.4E-25434491IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:1900150Biological Processregulation of defense response to fungus
GO:1900425Biological Processnegative regulation of defense response to bacterium
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 542 aa     Download sequence    Send to blast
MANNQDHHSS STSKSKASPG APPRPTISLP PRPFADVFFN GGWPGSGAGL GMGFSPGPMT  60
LVSSFFSDSD DCKSFSQLLA GAMASPAAQQ RPGFPPHPPD DKGSGETNIS ASAGDGAGSS  120
GDFEGRLRQN RPTGLVITQP PSIFTEPPGL NPATLLDSQG FSLFSPGPFG MTHQQALMQV  180
TAQAAQANSN MHVQAEHSSS VPAATSEHLP STTVKTDVNQ QMALSIIDTR LATKESSDLS  240
LPEHRPQPPS FSIDKPADDG YNWRKYGQKQ VKGSEFPRSY YKCTHPSCPV KKKVERSLDG  300
QITEIIYKGQ HNHQPPQSNK RAKDNSSSHN QGNSEFSSRS QSDNFNKPKE GASVYSMSQK  360
DQELTHPTPE HVSCTSDSED VGDAEAGTDV KDEDEPDPKR RSMESRVIEP ASSHRTVTEP  420
RIIVQTTSEV DLLDDGYKWR KYGQKVVKGN PYPRSYYKCT TPGCNVRKHV ERASTDARAV  480
ITTYEGKHNH EVPTAKSSSH NTASSNASQL KPLNVVGEKL ALTNSNQQPV ARLRLKEEQI  540
T*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2lex_A2e-40258493877Probable WRKY transcription factor 4
1wj2_A2e-40258493877Probable WRKY transcription factor 4
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007045981.10.0WRKY DNA-binding protein 4, putative isoform 2
SwissprotQ9XI900.0WRKY4_ARATH; Probable WRKY transcription factor 4
TrEMBLA0A061EB130.0A0A061EB13_THECC; WRKY DNA-binding protein 4, putative isoform 2
STRINGPOPTR_0010s17040.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM15342792
Representative plantOGRP1417875
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G13960.11e-170WRKY DNA-binding protein 4